Cognitive & Longevity
FOXO4-DRI
Research material supplied with clear product information and batch documentation available upon request.
COA Verified View Purity Report ↗ 99.54%For laboratory research only. Not for human or veterinary use, consumption, diagnosis, treatment or prevention of disease.
Certificate of Analysis
Search COA library →FOXO4-DRI
- COA number
- FOX4713R
- Reported
- 2026-07-27
- Status
- Verified
- Method
- See certificate details
FOXO4-DRI Product Specifications
| Property | Details |
|---|---|
| Product Contents | FOXO4-DRI lyophilized powder in sealed 3 mL glass vials; 10 vials per kit. |
| Available Sizes | 10 mg per vial × 10 vials |
| Peptide Type | Synthetic D-retro-inverso research peptide |
| Purity | ≥99% by HPLC (product specification; batch result documented on the Certificate of Analysis) |
| Molecular Formula | C228H388N86O64 |
| Molecular Weight | 5358.05 g/mol |
| Sequence | LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG (D-amino-acid form) |
| CAS Number | 2460055-10-9 |
| PubChem CID | 167312269 |
| Appearance | White lyophilized powder in sealed glass vials |
| Storage | Store sealed at 6°C or below, protected from heat, light and moisture. |
| Solubility | Soluble in water |
Research use only. Not for human or veterinary use, consumption, diagnosis, treatment or disease prevention. Batch-specific analytical results are controlled by the Certificate of Analysis.
Product FAQ.
General
Do you also sell products on other websites or platforms?
Why are research-use disclaimers shown throughout the website?
Newt supplies materials solely for qualified laboratory research. The products are not for human or veterinary use, consumption, diagnosis, treatment or prevention of disease. Product listings do not authorize any use outside lawful laboratory research.
Where are Newt orders dispatched from?
Newt orders are dispatched from our warehouse in Hong Kong. The available carrier, route and delivery estimate depend on the destination, product and current logistics conditions.
Products & Storage
What vial sizes and package formats are available?
Vial capacity, fill amount and package quantity vary by product and specification. Check the selected variation and order summary, or contact support with the exact product name before ordering.
How should lyophilized research peptides be stored?
To maximize shelf life, lyophilized peptides should be stored in a refrigerator or freezer before reconstitution. If stored properly, they can remain stable for several years.
How should reconstituted peptides be stored?
After reconstitution, peptide compounds should be stored in a refrigerator and used within an appropriate research timeframe according to laboratory procedures.
How should bacteriostatic water be stored?
Follow the storage statement on the supplied container and the manufacturer documentation. Keep the container protected from unsuitable heat, light and contamination, and do not use a damaged or compromised vial.
What is the ideal temperature for my products during research?
Before use in any experimental setup, peptides and bacteriostatic water should be brought to room temperature.
Quality & Testing
Is every batch independently tested?
Shipping
Where do you ship from, and can you ship to my country or region?
Orders ship from Hong Kong. Worldwide shipping is available.
How long does delivery take?
Estimated delivery times are 3–5 days for North America, 5–10 days for Europe, 3–7 days for Southeast Asia, 5–10 days for Oceania, and 5–10 days for South America.
Will I receive tracking information?
Orders are dispatched within 24–36 hours after payment. You will receive a tracking number and be kept updated on the status of your order.
Can customs clearance be guaranteed?
Yes. We use a dedicated research-logistics route with a 99.8% customs-clearance rate, and we manage the process from start to finish so you do not need to handle it. If customs clearance is unsuccessful after dispatch, we will coordinate an appropriate reshipment.
On which days are orders dispatched?
Orders are processed on Hong Kong business days, excluding applicable public holidays. Orders placed after processing begins, during holidays or in high-volume periods may move to the next available business day.
Is your shipping discreet?
Yes. We take your privacy seriously. Orders are shipped in standard, discreet carrier packaging with no indication of the contents. The available carrier and route depend on the destination and current logistics conditions. The return address does not include information about peptides or research materials.
My package shows as delivered, but I have not received it. What should I do?
If tracking shows “delivered” but you have not received the package:
- Step 1: Carefully check around your property and ask neighbors or household members.
- Step 2: Contact the local carrier office.
- Step 3: Submit a missing-package claim directly to the carrier.
- Step 4: Send us the claim number so our team can assist with reshipment.
We are always here to help and will make every reasonable effort to ensure your order is delivered.
What if I entered the wrong shipping address?
Contact support immediately with the order number and corrected address. We will try to update it before dispatch, but a change cannot be guaranteed once preparation, label creation or shipment has started.
Orders
Can I change my order after it has been confirmed?
Does Newt offer a membership program?
Returns & Refunds
What should I do if I receive the wrong item?
Keep the item and all packaging unchanged. Contact support within 7 calendar days after recorded delivery with the order number and clear photographs so the shipment can be reviewed before a resolution is confirmed.
What is the refund policy?
Because of the sensitive nature of research materials:
- Unshipped orders: Eligible for a full refund upon request.
- Dispatched or delivered orders: No refunds.
We provide a free replacement for products damaged in transit. If your product arrives damaged, take photographs and contact us so we can send a replacement promptly.
Important: Once an order has been dispatched, we cannot issue a refund. Because of the nature of research materials, products cannot be restocked or resold after leaving our facility.
Do you accept returns or exchanges?
Because of the sensitive nature of our research materials, all sales are final once an order has been dispatched.
- Unshipped orders: May be cancelled for a full refund.
- Dispatched or delivered orders: No returns, exchanges or refunds.
This policy exists because research materials cannot be restocked or resold after leaving our facility.
Exception: If you receive a damaged or incorrect product, contact us and provide photographs. We will replace it free of charge.